DCTN3 (NM_007234) Human Recombinant Protein

DCTN3 protein,

Recombinant protein of human dynactin 3 (p22) (DCTN3), transcript variant 1

Product Info Summary

SKU: PROTO75935
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DCTN3 (NM_007234) Human Recombinant Protein

View all DCTN3 recombinant proteins

SKU/Catalog Number

PROTO75935

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dynactin 3 (p22) (DCTN3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DCTN3 (NM_007234) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75935)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.9 kDa

Amino Acid Sequence

MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPAEE

Validation Images & Assay Conditions

Gene/Protein Information For DCTN3 (Source: Uniprot.org, NCBI)

Gene Name

DCTN3

Full Name

Dynactin subunit 3

Weight

20.9 kDa

Superfamily

dynactin subunit 3 family

Alternative Names

DCTN22DCTN-22; dynactin 3 (p22); dynactin 3; Dynactin complex subunit 22 kDa subunit; dynactin light chain; dynactin subunit 3; MGC111190; p22 DCTN3 DCTN-22, DCTN22 dynactin subunit 3 dynactin subunit 3|dynactin 3 (p22)|dynactin complex subunit 22 kDa subunit|dynactin light chain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DCTN3, check out the DCTN3 Infographic

DCTN3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DCTN3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75935

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DCTN3 (NM_007234) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DCTN3 (NM_007234) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DCTN3 (NM_007234) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75935
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product