DARS2 (NM_018122) Human Recombinant Protein

DARS2 protein,

Recombinant protein of human aspartyl-tRNA synthetase 2, mitochondrial (DARS2), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTQ6PI48
Size: 20 µg
Source: HEK293T

Product Name

DARS2 (NM_018122) Human Recombinant Protein

View all DARS2 recombinant proteins

SKU/Catalog Number

PROTQ6PI48

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human aspartyl-tRNA synthetase 2, mitochondrial (DARS2), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DARS2 (NM_018122) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6PI48)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

73.4 kDa

Amino Acid Sequence

MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

Validation Images & Assay Conditions

Gene/Protein Information For DARS2 (Source: Uniprot.org, NCBI)

Gene Name

DARS2

Full Name

Aspartate--tRNA ligase, mitochondrial

Weight

73.4 kDa

Superfamily

class-II aminoacyl-tRNA synthetase family

Alternative Names

aspartate tRNA ligase 2, mitochondrial; Aspartate--tRNA ligase; aspartyl-tRNA synthetase 2, mitochondrial; aspartyl-tRNA synthetase, mitochondrial; AspRS; ASPRS. LBSL; EC 6.1.1; EC 6.1.1.12; FLJ10514; LBSL; MT-ASPRS; RP3-383J4.2 DARS2 ASPRS, LBSL, MT-ASPRS, mtAspRS aspartyl-tRNA synthetase 2, mitochondrial aspartate--tRNA ligase, mitochondrial|aspartate tRNA ligase 2, mitochondrial|aspartyl-tRNA synthetase, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DARS2, check out the DARS2 Infographic

DARS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DARS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6PI48

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DARS2 (NM_018122) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DARS2 (NM_018122) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DARS2 (NM_018122) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6PI48
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.