DAB1 (NM_021080) Human Recombinant Protein

DAB1 protein,

Recombinant protein of human disabled homolog 1 (Drosophila) (DAB1)

Product Info Summary

SKU: PROTO75553
Size: 20 µg
Source: HEK293T

Product Name

DAB1 (NM_021080) Human Recombinant Protein

View all DAB1 recombinant proteins

SKU/Catalog Number

PROTO75553

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human disabled homolog 1 (Drosophila) (DAB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DAB1 (NM_021080) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75553)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

59.8 kDa

Amino Acid Sequence

MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS

Validation Images & Assay Conditions

Gene/Protein Information For DAB1 (Source: Uniprot.org, NCBI)

Gene Name

DAB1

Full Name

Disabled homolog 1

Weight

59.8 kDa

Alternative Names

disabled (Drosophila) homolog 1; disabled homolog 1 (Drosophila); disabled homolog 1 DAB1 SCA37 DAB adaptor protein 1 disabled homolog 1|DAB1, reelin adaptor protein|Dab reelin signal transducer 1|Dab, reelin signal transducer, homolog 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DAB1, check out the DAB1 Infographic

DAB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DAB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75553

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DAB1 (NM_021080) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DAB1 (NM_021080) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DAB1 (NM_021080) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75553
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.