CTDSPL (NM_005808) Human Recombinant Protein

CTDSPL protein,

Product Info Summary

SKU: PROTO15194
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CTDSPL (NM_005808) Human Recombinant Protein

View all CTDSPL recombinant proteins

SKU/Catalog Number

PROTO15194

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CTDSPL (NM_005808) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15194)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.8 kDa

Amino Acid Sequence

MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR

Validation Images & Assay Conditions

Gene/Protein Information For CTDSPL (Source: Uniprot.org, NCBI)

Gene Name

CTDSPL

Full Name

CTD small phosphatase-like protein

Weight

29.8 kDa

Alternative Names

C3orf8; Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like; CTD small phosphatase-like protein; CTDSP-like; EC 3.1.3; HYA22; NIF1; NIFL; NIF-like protein; NLI-interacting factor 1; Nuclear LIM interactor-interacting factor 1; Protein YA22; PSR1; RB protein serine phosphatase from chromosome 3; RBSP3EC 3.1.3.16; SCP3chromosome 3 open reading frame 8; Small CTD phosphatase 3; Small C-terminal domain phosphatase 3; YA22 CTDSPL C3orf8, HYA22, PSR1, RBSP3, SCP3 CTD small phosphatase like CTD small phosphatase-like protein|CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like|CTDSP-like|NIF-like protein|NLI-interacting factor 1|RB protein serine phosphatase from chromosome 3|carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3|nuclear LIM interactor-interacting factor 1|small C-terminal domain phosphatase 3|small CTD phosphatase 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CTDSPL, check out the CTDSPL Infographic

CTDSPL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CTDSPL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15194

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CTDSPL (NM_005808) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CTDSPL (NM_005808) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CTDSPL (NM_005808) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15194
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.