CSNK2A2 (NM_001896) Human Recombinant Protein

CKII alpha prime polypeptide protein,

Product Info Summary

SKU: PROTP19784
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CSNK2A2 (NM_001896) Human Recombinant Protein

View all CKII alpha prime polypeptide recombinant proteins

SKU/Catalog Number

PROTP19784

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human casein kinase 2, alpha prime polypeptide (CSNK2A2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CSNK2A2 (NM_001896) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19784)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41 kDa

Amino Acid Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Validation Images & Assay Conditions

Gene/Protein Information For CSNK2A2 (Source: Uniprot.org, NCBI)

Gene Name

CSNK2A2

Full Name

Casein kinase II subunit alpha'

Weight

41 kDa

Superfamily

protein kinase superfamily

Alternative Names

casein kinase 2, alpha prime polypeptide; casein kinase II subunit alpha'; CK II alpha'; CK2A2; CSNK2A1; EC 2.7.11; EC 2.7.11.1; FLJ43934 CSNK2A2 CK2A2, CK2alpha, CSNK2A1 casein kinase 2 alpha 2 casein kinase II subunit alpha|CK II alpha|casein kinase 2 alpha|casein kinase 2, alpha prime polypeptide

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSNK2A2, check out the CSNK2A2 Infographic

CSNK2A2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSNK2A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19784

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CSNK2A2 (NM_001896) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CSNK2A2 (NM_001896) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CSNK2A2 (NM_001896) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP19784
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.