Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein

Casein Kinase 2 beta protein,

Product Info Summary

SKU: PROTP67870
Size: 20 µg
Source: HEK293T

Product Name

Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein

View all Casein Kinase 2 beta recombinant proteins

SKU/Catalog Number

PROTP67870

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human casein kinase 2, beta polypeptide (CSNK2B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP67870)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.8 kDa

Amino Acid Sequence

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Validation Images & Assay Conditions

Gene/Protein Information For CSNK2B (Source: Uniprot.org, NCBI)

Gene Name

CSNK2B

Full Name

Casein kinase II subunit beta

Weight

24.8 kDa

Superfamily

casein kinase 2 subunit beta family

Alternative Names

Casein Kinase 2 beta; casein kinase 2, beta polypeptide; Casein kinase II beta subunit; casein kinase II subunit beta; CK II beta; CK2B; CK2N; CSK2B; CSNK2B; G5A; MGC138222; MGC138224; Phosvitin; Protein G5a CSNK2B CK2B, CK2N, CSK2B, Ckb1, Ckb2, G5A, POBINDS casein kinase 2 beta casein kinase II subunit beta|CK II beta|CSNK2B-LY6G5B-1072|CSNK2B-LY6G5B-1103|CSNK2B-LY6G5B-532|CSNK2B-LY6G5B-560|CSNK2B-LY6G5B-562|Casein kinase II beta subunit|alternative name: G5a, phosvitin|casein kinase 2, beta polypeptide|phosvitin|protein G5a

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSNK2B, check out the CSNK2B Infographic

CSNK2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSNK2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP67870
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.