CRY2 (NM_021117) Human Recombinant Protein

CRY2 protein,

Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1

Product Info Summary

SKU: PROTQ49AN0
Size: 20 µg
Source: HEK293T

Product Name

CRY2 (NM_021117) Human Recombinant Protein

View all CRY2 recombinant proteins

SKU/Catalog Number

PROTQ49AN0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRY2 (NM_021117) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ49AN0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

66.8 kDa

Amino Acid Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA

Validation Images & Assay Conditions

Gene/Protein Information For CRY2 (Source: Uniprot.org, NCBI)

Gene Name

CRY2

Full Name

Cryptochrome-2

Weight

66.8 kDa

Superfamily

DNA photolyase class-1 family

Alternative Names

cryptochrome 2 (photolyase-like); cryptochrome-2; FLJ10332; growth-inhibiting protein 37; HCRY2; KIAA0658; PHLL2 CRY2 HCRY2, PHLL2 cryptochrome circadian regulator 2 cryptochrome-2|cryptochrome 2 (photolyase-like)|cryptochrome circadian clock 2|growth-inhibiting protein 37

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRY2, check out the CRY2 Infographic

CRY2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRY2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ49AN0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRY2 (NM_021117) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRY2 (NM_021117) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRY2 (NM_021117) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ49AN0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.