CRMP1 (NM_001313) Human Recombinant Protein

CRMP1 protein,

Product Info Summary

SKU: PROTQ14194
Size: 20 µg
Source: HEK293T

Product Name

CRMP1 (NM_001313) Human Recombinant Protein

View all CRMP1 recombinant proteins

SKU/Catalog Number

PROTQ14194

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human collapsin response mediator protein 1 (CRMP1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRMP1 (NM_001313) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14194)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

62 kDa

Amino Acid Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Validation Images & Assay Conditions

Gene/Protein Information For CRMP1 (Source: Uniprot.org, NCBI)

Gene Name

CRMP1

Full Name

Dihydropyrimidinase-related protein 1

Weight

62 kDa

Superfamily

metallo-dependent hydrolases superfamily

Alternative Names

collapsin response mediator protein 1DRP1; CRMP-1; dihydropyrimidinase-like 1; dihydropyrimidinase-related protein 1; DPYSL1DRP-1dihydropyrimidinase related protein-1; ULIP3; ULIP-3; Unc-33-like phosphoprotein 3 CRMP1 CRMP-1, DPYSL1, DRP-1, DRP1, ULIP-3 collapsin response mediator protein 1 dihydropyrimidinase-related protein 1|dihydropyrimidinase-like 1|inactive dihydropyrimidinase|unc-33-like phosphoprotein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRMP1, check out the CRMP1 Infographic

CRMP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRMP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14194

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRMP1 (NM_001313) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRMP1 (NM_001313) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRMP1 (NM_001313) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14194
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.