CRIP2 (NM_001312) Human Recombinant Protein

CRIP2 protein,

Recombinant protein of human cysteine-rich protein 2 (CRIP2)

Product Info Summary

SKU: PROTP52943
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CRIP2 (NM_001312) Human Recombinant Protein

View all CRIP2 recombinant proteins

SKU/Catalog Number

PROTP52943

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cysteine-rich protein 2 (CRIP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRIP2 (NM_001312) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP52943)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.3 kDa

Amino Acid Sequence

MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

Validation Images & Assay Conditions

Gene/Protein Information For CRIP2 (Source: Uniprot.org, NCBI)

Gene Name

CRIP2

Full Name

Cysteine-rich protein 2

Weight

22.3 kDa

Alternative Names

CRIP; CRP-2; CRP2ESP1; cysteine-rich protein 2; Cystein-rich intestinal protein; Protein ESP1 CRIP2 CRIP, CRP2, ESP1 cysteine rich protein 2 cysteine-rich protein 2|Cysteine-rich intestinal protein|LIM domain protein ESP1/CRP2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRIP2, check out the CRIP2 Infographic

CRIP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRIP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP52943

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRIP2 (NM_001312) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRIP2 (NM_001312) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRIP2 (NM_001312) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP52943
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.