CRIP1 (NM_001311) Human Recombinant Protein

CRIP1 protein,

Product Info Summary

SKU: PROTP50238
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CRIP1 (NM_001311) Human Recombinant Protein

View all CRIP1 recombinant proteins

SKU/Catalog Number

PROTP50238

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cysteine-rich protein 1 (intestinal) (CRIP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRIP1 (NM_001311) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50238)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.4 kDa

Amino Acid Sequence

MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Validation Images & Assay Conditions

Gene/Protein Information For CRIP1 (Source: Uniprot.org, NCBI)

Gene Name

CRIP1

Full Name

Cysteine-rich protein 1

Weight

8.4 kDa

Alternative Names

CRHP; CRIPCRP1; CRP-1; Cysteine-rich heart protein; Cysteine-rich intestinal protein; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; FLJ40971; hCRHP CRIP1 CRHP, CRIP, CRP-1, CRP1 cysteine rich protein 1 cysteine-rich protein 1|cysteine-rich heart protein|cysteine-rich intestinal protein|cysteine-rich protein 1 (intestinal)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRIP1, check out the CRIP1 Infographic

CRIP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRIP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50238

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRIP1 (NM_001311) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRIP1 (NM_001311) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRIP1 (NM_001311) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP50238
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.