CRABP2 (NM_001878) Human Recombinant Protein

CRABP2 protein,

Product Info Summary

SKU: PROTP29373
Size: 20 µg
Source: HEK293T

Product Name

CRABP2 (NM_001878) Human Recombinant Protein

View all CRABP2 recombinant proteins

SKU/Catalog Number

PROTP29373

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cellular retinoic acid binding protein 2 (CRABP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRABP2 (NM_001878) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP29373)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.5 kDa

Amino Acid Sequence

MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Validation Images & Assay Conditions

Gene/Protein Information For CRABP2 (Source: Uniprot.org, NCBI)

Gene Name

CRABP2

Full Name

Cellular retinoic acid-binding protein 2

Weight

15.5 kDa

Superfamily

calycin superfamily

Alternative Names

cellular retinoic acid binding protein 2; Cellular retinoic acid-binding protein II; CRABP2; CRABP-II; CRABP-IIcellular retinoic acid-binding protein 2; RBP6 CRABP2 CRABP-II, RBP6 cellular retinoic acid binding protein 2 cellular retinoic acid-binding protein 2|cellular retinoic acid-binding protein II

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRABP2, check out the CRABP2 Infographic

CRABP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRABP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP29373

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRABP2 (NM_001878) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRABP2 (NM_001878) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRABP2 (NM_001878) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP29373
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.