COX4NB (EMC8) (NM_006067) Human Recombinant Protein

COX4NB protein,

Product Info Summary

SKU: PROTO43402
Size: 20 µg
Source: HEK293T

Product Name

COX4NB (EMC8) (NM_006067) Human Recombinant Protein

View all COX4NB recombinant proteins

SKU/Catalog Number

PROTO43402

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human COX4 neighbor (COX4NB), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COX4NB (EMC8) (NM_006067) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43402)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.6 kDa

Amino Acid Sequence

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Validation Images & Assay Conditions

Gene/Protein Information For EMC8 (Source: Uniprot.org, NCBI)

Gene Name

EMC8

Full Name

ER membrane protein complex subunit 8

Weight

23.6 kDa

Superfamily

EMC8/EMC9 family

Alternative Names

C16orf2; C16orf4; chromosome 16 open reading frame 2; COX4 neighbor; COX4AL; FAM158Bchromosome 16 open reading frame 4; neighbor of COX4; NOC4family with sequence similarity 158, member B; Protein FAM158B EMC8 C16orf2, C16orf4, COX4NB, FAM158B, NOC4 ER membrane protein complex subunit 8 ER membrane protein complex subunit 8|COX4 neighbor|family with sequence similarity 158, member B|neighbor of COX4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EMC8, check out the EMC8 Infographic

EMC8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EMC8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43402

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COX4NB (EMC8) (NM_006067) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COX4NB (EMC8) (NM_006067) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COX4NB (EMC8) (NM_006067) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43402
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.