COPZ1 (NM_016057) Human Recombinant Protein

COPZ1 protein,

Product Info Summary

SKU: PROTP61923
Size: 20 µg
Source: HEK293T

Product Name

COPZ1 (NM_016057) Human Recombinant Protein

View all COPZ1 recombinant proteins

SKU/Catalog Number

PROTP61923

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coatomer protein complex, subunit zeta 1 (COPZ1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COPZ1 (NM_016057) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61923)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20 kDa

Amino Acid Sequence

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Validation Images & Assay Conditions

Gene/Protein Information For COPZ1 (Source: Uniprot.org, NCBI)

Gene Name

COPZ1

Full Name

Coatomer subunit zeta-1

Weight

20 kDa

Superfamily

adaptor complexes small subunit family

Alternative Names

Coatomer subunit zeta-1 COPZ1 CGI-120, COPZ, HSPC181, zeta-COP, zeta1-COP COPI coat complex subunit zeta 1 coatomer subunit zeta-1|coatomer protein complex subunit zeta 1|coatomer protein complex, subunit zeta|zeta-1 COP|zeta-1-coat protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COPZ1, check out the COPZ1 Infographic

COPZ1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COPZ1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61923

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COPZ1 (NM_016057) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COPZ1 (NM_016057) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COPZ1 (NM_016057) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61923
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.