COPE (NM_007263) Human Recombinant Protein

COPE protein,

Product Info Summary

SKU: PROTO14579
Size: 20 µg
Source: HEK293T

Product Name

COPE (NM_007263) Human Recombinant Protein

View all COPE recombinant proteins

SKU/Catalog Number

PROTO14579

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coatomer protein complex, subunit epsilon (COPE), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COPE (NM_007263) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14579)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.3 kDa

Amino Acid Sequence

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA

Validation Images & Assay Conditions

Gene/Protein Information For COPE (Source: Uniprot.org, NCBI)

Gene Name

COPE

Full Name

Coatomer subunit epsilon

Weight

34.3 kDa

Superfamily

COPE family

Alternative Names

coatomer epsilon subunit; coatomer protein complex, subunit epsilon; coatomer subunit epsilon; epsilon coat protein; Epsilon-coat protein; epsilon-COP; FLJ13241 COPE epsilon-COP COPI coat complex subunit epsilon coatomer subunit epsilon|coatomer epsilon subunit|coatomer protein complex subunit epsilon|epsilon coat protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COPE, check out the COPE Infographic

COPE infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COPE: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14579

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COPE (NM_007263) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COPE (NM_007263) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COPE (NM_007263) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14579
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.