COP (CARD16) (NM_052889) Human Recombinant Protein

COP protein,

Recombinant protein of human caspase recruitment domain family, member 16 (CARD16), transcript variant 2

Product Info Summary

SKU: PROTQ5EG05
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COP (CARD16) (NM_052889) Human Recombinant Protein

View all COP recombinant proteins

SKU/Catalog Number

PROTQ5EG05

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human caspase recruitment domain family, member 16 (CARD16), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COP (CARD16) (NM_052889) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5EG05)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.6 kDa

Amino Acid Sequence

MRKAMADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN

Validation Images & Assay Conditions

Gene/Protein Information For CARD16 (Source: Uniprot.org, NCBI)

Gene Name

CARD16

Full Name

Caspase recruitment domain-containing protein 16

Weight

10.6 kDa

Alternative Names

CARD only domain-containing protein 1; CARD only protein; caspase recruitment domain family, member 16; Caspase-1 inhibitor COP; COP1caspase-1 dominant-negative inhibitor pseudo-ICE; COPcaspase recruitment domain-containing protein 16; EC 3.4.22.36; Pseudo interleukin-1 beta converting enzyme; pseudo interleukin-1beta converting enzyme; PSEUDO-ICE CARD16 COP, COP1, LLID-114769, PSEUDO-ICE caspase recruitment domain family member 16 caspase recruitment domain-containing protein 16|CARD only domain-containing protein 1|CARD only protein|CARD-only protein 1|caspase recruitment domain-only protein 1|caspase-1 dominant-negative inhibitor pseudo-ICE|caspase-1 inhibitor COP|pseudo interleukin-1 beta converting enzyme|pseudo interleukin-1beta converting enzyme|pseudo-IL1B-converting enzyme

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CARD16, check out the CARD16 Infographic

CARD16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CARD16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5EG05

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COP (CARD16) (NM_052889) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COP (CARD16) (NM_052889) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COP (CARD16) (NM_052889) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5EG05
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product