CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein

CD300LG/Nepmucin protein,

Purified recombinant protein of Homo sapiens CD300 molecule-like family member g (CD300LG), transcript variant 3.

Product Info Summary

SKU: PROTQ6UXG3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein

View all CD300LG/Nepmucin recombinant proteins

SKU/Catalog Number

PROTQ6UXG3

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens CD300 molecule-like family member g (CD300LG), transcript variant 3.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6UXG3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0304kDa

Amino Acid Sequence

MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPASPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLNSLMFSLSLPWL

Validation Images & Assay Conditions

Gene/Protein Information For CD300LG (Source: Uniprot.org, NCBI)

Gene Name

CD300LG

Full Name

CMRF35-like molecule 9

Weight

0.0304kDa

Superfamily

CD300 family

Alternative Names

CD300 antigen like family member G; CD300 antigen-like family member G; CD300 molecule like family member g; CD300 molecule-like family member g; CD300g antigen; CD300g; CD300LG; CLM9; CLM-9; CLM9Trem4; CMRF35-like molecule 9; Nepmucin; TREM4; TREM-4; Triggering receptor expressed on myeloid cells 4 Cd300lg|2310016B05Rik, Clm, Clm9, D11Ertd736, D11Ertd736e, nepm|CD300 molecule like family member G|CMRF35-like molecule 9|CD300 like family member G|CLM-9|CMRF-35-like molecule-9|nepmucin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD300LG, check out the CD300LG Infographic

CD300LG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD300LG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6UXG3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6UXG3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.