CLEC10A (NM_006344) Human Recombinant Protein

CLEC10A protein,

Product Info Summary

SKU: PROTQ8IUN9
Size: 20 µg
Source: HEK293T

Product Name

CLEC10A (NM_006344) Human Recombinant Protein

View all CLEC10A recombinant proteins

SKU/Catalog Number

PROTQ8IUN9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CLEC10A (NM_006344) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IUN9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.7 kDa

Amino Acid Sequence

MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Validation Images & Assay Conditions

Gene/Protein Information For CLEC10A (Source: Uniprot.org, NCBI)

Gene Name

CLEC10A

Full Name

C-type lectin domain family 10 member A

Weight

32.7 kDa

Alternative Names

CD301 antigen; CD301; CD301C-type lectin domain family 10 member A; CLEC10A; CLECSF13; CLECSF14; CLECSF14macrophage C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 14 (macrophage-derived); C-type lectin domain family 10, member A; C-type lectin superfamily member 14; HML2; HMLC-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 13 (macrophage-derived); macrophage lectin 2 (calcium dependent); Macrophage lectin 2; MGL CLEC10A CD301, CLECSF13, CLECSF14, HML, HML2, MGL C-type lectin domain containing 10A C-type lectin domain family 10 member A|C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived)|C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived)|macrophage lectin 2 (calcium dependent)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLEC10A, check out the CLEC10A Infographic

CLEC10A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLEC10A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IUN9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CLEC10A (NM_006344) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CLEC10A (NM_006344) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CLEC10A (NM_006344) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IUN9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.