Claudin 4 (CLDN4) (NM_001305) Human Recombinant Protein

Claudin-4 protein,

Product Info Summary

SKU: PROTO14493
Size: 20 µg
Source: HEK293T

Product Name

Claudin 4 (CLDN4) (NM_001305) Human Recombinant Protein

View all Claudin-4 recombinant proteins

SKU/Catalog Number

PROTO14493

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human claudin 4 (CLDN4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Claudin 4 (CLDN4) (NM_001305) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14493)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.9 kDa

Amino Acid Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Validation Images & Assay Conditions

Gene/Protein Information For CLDN4 (Source: Uniprot.org, NCBI)

Gene Name

CLDN4

Full Name

Claudin-4

Weight

21.9 kDa

Superfamily

claudin family

Alternative Names

claudin 4; Claudin4; Claudin-4; CLDN4; Clostridium perfringens enterotoxin receptor 1; Clostridium perfringens enterotoxin receptor; CPE-R; CPE-RCPETR; CPE-receptor; CPETR1; hCPE-R; WBSCR8; WBSCR8CPERCPETR1claudin-4; Williams-Beuren syndrome chromosomal region 8 protein CLDN4 CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R claudin 4 claudin-4|CPE-receptor|Clostridium perfringens enterotoxin receptor 1|Williams-Beuren syndrome chromosomal region 8 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLDN4, check out the CLDN4 Infographic

CLDN4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLDN4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14493

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Claudin 4 (CLDN4) (NM_001305) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Claudin 4 (CLDN4) (NM_001305) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Claudin 4 (CLDN4) (NM_001305) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14493
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.