Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein

CLTB protein,

Product Info Summary

SKU: PROTP09497
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein

View all CLTB recombinant proteins

SKU/Catalog Number

PROTP09497

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human clathrin, light chain (Lcb) (CLTB), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09497)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25 kDa

Amino Acid Sequence

MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For CLTB (Source: Uniprot.org, NCBI)

Gene Name

CLTB

Full Name

Clathrin light chain B

Weight

25 kDa

Superfamily

clathrin light chain family

Alternative Names

clathrin light chain B; clathrin, light chain (Lcb); clathrin, light chain B; clathrin, light polypeptide (Lcb); Lcb CLTB LCB clathrin light chain B clathrin light chain B|clathrin, light chain (Lcb)|clathrin, light polypeptide (Lcb)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLTB, check out the CLTB Infographic

CLTB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLTB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09497

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09497
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.