CITED1 (NM_004143) Human Recombinant Protein

CITED1 protein,

Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1

Product Info Summary

SKU: PROTQ99966
Size: 20 µg
Source: HEK293T

Product Name

CITED1 (NM_004143) Human Recombinant Protein

View all CITED1 recombinant proteins

SKU/Catalog Number

PROTQ99966

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CITED1 (NM_004143) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99966)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.7 kDa

Amino Acid Sequence

MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Validation Images & Assay Conditions

Gene/Protein Information For CITED1 (Source: Uniprot.org, NCBI)

Gene Name

CITED1

Full Name

Cbp/p300-interacting transactivator 1

Weight

19.7 kDa

Superfamily

CITED family

Alternative Names

cbp/p300-interacting transactivator 1; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1; melanocyte-specific gene 1 CITED1 MSG1 Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1 cbp/p300-interacting transactivator 1|melanocyte-specific gene 1|melanocyte-specific protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CITED1, check out the CITED1 Infographic

CITED1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CITED1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99966

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CITED1 (NM_004143) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CITED1 (NM_004143) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CITED1 (NM_004143) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99966
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.