CIAO1 (NM_004804) Human Recombinant Protein

CIAO1 protein,

Product Info Summary

SKU: PROTO76071
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CIAO1 (NM_004804) Human Recombinant Protein

View all CIAO1 recombinant proteins

SKU/Catalog Number

PROTO76071

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae) (CIAO1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CIAO1 (NM_004804) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO76071)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.7 kDa

Amino Acid Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Validation Images & Assay Conditions

Gene/Protein Information For CIAO1 (Source: Uniprot.org, NCBI)

Gene Name

CIAO1

Full Name

Probable cytosolic iron-sulfur protein assembly protein CIAO1

Weight

37.7 kDa

Superfamily

WD repeat CIA1 family

Alternative Names

CIA1; cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae); cytosolic iron-sulfur protein assembly 1; probable cytosolic iron-sulfur protein assembly protein CIAO1; WD repeat domain 39; WD repeat-containing protein 39; WD40 protein Ciao1; WDR39cytosolic iron-sulfur protein assembly 1 homolog CIAO1 CIA1, WDR39 cytosolic iron-sulfur assembly component 1 probable cytosolic iron-sulfur protein assembly protein CIAO1|WD repeat domain 39|WD repeat-containing protein 39|WD40 protein Ciao1|cytosolic iron-sulfur protein assembly 1 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CIAO1, check out the CIAO1 Infographic

CIAO1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CIAO1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO76071

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CIAO1 (NM_004804) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CIAO1 (NM_004804) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CIAO1 (NM_004804) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO76071
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.