CHX10 (VSX2) (NM_182894) Human Recombinant Protein

CHX10 protein,

Recombinant protein of human visual system homeobox 2 (VSX2)

Product Info Summary

SKU: PROTP58304
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CHX10 (VSX2) (NM_182894) Human Recombinant Protein

View all CHX10 recombinant proteins

SKU/Catalog Number

PROTP58304

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human visual system homeobox 2 (VSX2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CHX10 (VSX2) (NM_182894) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP58304)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.2 kDa

Amino Acid Sequence

MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA

Validation Images & Assay Conditions

Gene/Protein Information For VSX2 (Source: Uniprot.org, NCBI)

Gene Name

VSX2

Full Name

Visual system homeobox 2

Weight

39.2 kDa

Superfamily

paired homeobox family

Alternative Names

ceh-10 homeo domain containing homolog (C. elegans); ceh-10 homeo domain containing homolog; ceh-10 homeodomain containing homolog (C. elegans); Ceh-10 homeodomain-containing homolog; CHX10MCOPCB3; Homeobox protein CHX10; HOX10C elegans ceh-10 homeo domain-containing homolog; MCOP2; RET1; visual system homeobox 2 Vsx2|Chx10, Hox-1, Hox-10, Hox1, Hox10, or|visual system homeobox 2|visual system homeobox 2|C. elegans ceh-10 homeo domain containing homolog|ceh-10 homeodomain-containing homolog|homeobox protein CHX10|ocular retardation

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VSX2, check out the VSX2 Infographic

VSX2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VSX2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP58304

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CHX10 (VSX2) (NM_182894) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CHX10 (VSX2) (NM_182894) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHX10 (VSX2) (NM_182894) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP58304
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.