CHMP5 (NM_001195536) Human Recombinant Protein

CHMP5 protein,

Product Info Summary

SKU: PROTQ9NZZ3
Size: 20 µg
Source: HEK293T

Product Name

CHMP5 (NM_001195536) Human Recombinant Protein

View all CHMP5 recombinant proteins

SKU/Catalog Number

PROTQ9NZZ3

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens chromatin modifying protein 5 (CHMP5), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CHMP5 (NM_001195536) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZZ3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.02kDa

Amino Acid Sequence

MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAGWSSGG

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For CHMP5 (Source: Uniprot.org, NCBI)

Gene Name

CHMP5

Full Name

Charged multivesicular body protein 5

Weight

0.02kDa

Superfamily

SNF7 family

Alternative Names

apoptosis-related protein PNAS-2; C9orf83; charged multivesicular body protein 5; chromatin modifying protein 5; Chromatin-modifying protein 5; chromosome 9 open reading frame 83; HSPC177; hVps60; PNAS-2; SNF7 domain containing 2; SNF7 domain-containing protein 2; SNF7DC2; Vacuolar protein sorting-associated protein 60; Vps60CGI-34 CHMP5 C9orf83, CGI-34, HSPC177, PNAS-2, SNF7DC2, Vps60 charged multivesicular body protein 5 charged multivesicular body protein 5|SNF7 domain containing 2|SNF7 domain-containing protein 2|apoptosis-related protein PNAS-2|chromatin-modifying protein 5|hVps60|vacuolar protein sorting-associated protein 60

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHMP5, check out the CHMP5 Infographic

CHMP5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHMP5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NZZ3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CHMP5 (NM_001195536) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CHMP5 (NM_001195536) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHMP5 (NM_001195536) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NZZ3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.