CHMP2B (NM_014043) Human Recombinant Protein

CHMP2B protein,

Product Info Summary

SKU: PROTQ9UQN3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CHMP2B (NM_014043) Human Recombinant Protein

View all CHMP2B recombinant proteins

SKU/Catalog Number

PROTQ9UQN3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromatin modifying protein 2B (CHMP2B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CHMP2B (NM_014043) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UQN3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.7 kDa

Amino Acid Sequence

MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD

Validation Images & Assay Conditions

Gene/Protein Information For CHMP2B (Source: Uniprot.org, NCBI)

Gene Name

CHMP2B

Full Name

Charged multivesicular body protein 2b

Weight

23.7 kDa

Superfamily

SNF7 family

Alternative Names

charged multivesicular body protein 2b; CHMP2.5; CHMP2.5VPS2BVPS2-2; CHMP2B; chromatin modifying protein 2B; Chromatin-modifying protein 2b; DKFZP564O123; DMT1; hVps2-2; Vacuolar protein sorting-associated protein 2-2; vacuolar protein-sorting-associated protein 2-2; VPS2 homolog B; Vps2-2; VPS2B CHMP2B ALS17, CHMP2.5, DMT1, FTDALS7, VPS2-2, VPS2B charged multivesicular body protein 2B charged multivesicular body protein 2b|VPS2 homolog B|chromatin modifying protein 2B|vacuolar protein-sorting-associated protein 2-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHMP2B, check out the CHMP2B Infographic

CHMP2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHMP2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UQN3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CHMP2B (NM_014043) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CHMP2B (NM_014043) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHMP2B (NM_014043) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UQN3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.