CHMP1A (NM_002768) Human Recombinant Protein

CHMP1A protein,

Product Info Summary

SKU: PROTQ9HD42
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CHMP1A (NM_002768) Human Recombinant Protein

View all CHMP1A recombinant proteins

SKU/Catalog Number

PROTQ9HD42

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens chromatin modifying protein 1A (CHMP1A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CHMP1A (NM_002768) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HD42)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.5 kDa

Amino Acid Sequence

MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN

Validation Images & Assay Conditions

Gene/Protein Information For CHMP1A (Source: Uniprot.org, NCBI)

Gene Name

CHMP1A

Full Name

Charged multivesicular body protein 1a

Weight

21.5 kDa

Superfamily

SNF7 family

Alternative Names

CHMP1; CHMP1charged multivesicular body protein 1/chromatin modifying protein 1; chromatin modifying protein 1A; Chromatin-modifying protein 1a; hVps46-1; KIAA0047charged multivesicular body protein 1a; PCOLN3protease, metallo, 1, 33kD; procollagen (type III) N-endopeptidase; PRSM1CHMP1a; Vacuolar protein sorting-associated protein 46-1; Vps46-1; VPS46A CHMP1A CHMP1, PCH8, PCOLN3, PRSM1, VPS46-1, VPS46A charged multivesicular body protein 1A charged multivesicular body protein 1a|charged multivesicular body protein 1/chromatin modifying protein 1|chromatin modifying protein 1A|procollagen (type III) N-endopeptidase|protease, metallo, 1, 33kD|vacuolar protein sorting-associated protein 46-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHMP1A, check out the CHMP1A Infographic

CHMP1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHMP1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used CHMP1A (NM_002768) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CHMP1A (NM_002768) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHMP1A (NM_002768) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HD42
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.