CFAP298 (NM_021254) Human Recombinant Protein

C21orf59 protein,

Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59)

Product Info Summary

SKU: PROTP57076
Size: 20 µg
Source: HEK293T

Product Name

CFAP298 (NM_021254) Human Recombinant Protein

View all C21orf59 recombinant proteins

SKU/Catalog Number

PROTP57076

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CFAP298 (NM_021254) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP57076)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33 kDa

Amino Acid Sequence

MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR

Validation Images & Assay Conditions

Gene/Protein Information For CFAP298 (Source: Uniprot.org, NCBI)

Gene Name

CFAP298

Full Name

Cilia- and flagella-associated protein 298

Weight

33 kDa

Superfamily

CFAP298 family

Alternative Names

C21orf48; chromosome 21 open reading frame 48; chromosome 21 open reading frame 59; FLJ20467; FLJ37137; FLJ40247; hypothetical protein LOC56683; kur; kurly CFAP298 C21orf48, C21orf59, CILD26, FBB18, Kur cilia and flagella associated protein 298 cilia- and flagella-associated protein 298|UPF0769 protein C21orf59|kurly homolog|prostate cancer upregulated protein 1|protein kurly homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CFAP298, check out the CFAP298 Infographic

CFAP298 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CFAP298: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP57076

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CFAP298 (NM_021254) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CFAP298 (NM_021254) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CFAP298 (NM_021254) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP57076
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.