CDK5RAP3 (NM_176096) Human Recombinant Protein

Cdk5rap3 protein,

Product Info Summary

SKU: PROTQ96JB5
Size: 20 µg
Source: HEK293T

Product Name

CDK5RAP3 (NM_176096) Human Recombinant Protein

View all Cdk5rap3 recombinant proteins

SKU/Catalog Number

PROTQ96JB5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CDK5 regulatory subunit associated protein 3 (CDK5RAP3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDK5RAP3 (NM_176096) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96JB5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

56.7 kDa

Amino Acid Sequence

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL

Validation Images & Assay Conditions

Gene/Protein Information For CDK5RAP3 (Source: Uniprot.org, NCBI)

Gene Name

CDK5RAP3

Full Name

CDK5 regulatory subunit-associated protein 3

Weight

56.7 kDa

Superfamily

CDK5RAP3 family

Alternative Names

C53; CDK5 activator-binding protein C53; CDK5 regulatory subunit associated protein 3; FLJ13660; HSF-27; IC53CDK5 regulatory subunit-associated protein 3; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; LZAP; MST016; OK/SW-cl.114; Protein HSF-27 Cdk5rap3|C53|CDK5 regulatory subunit associated protein 3|CDK5 regulatory subunit-associated protein 3|CDK5 activator-binding protein C53

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDK5RAP3, check out the CDK5RAP3 Infographic

CDK5RAP3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDK5RAP3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96JB5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDK5RAP3 (NM_176096) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDK5RAP3 (NM_176096) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDK5RAP3 (NM_176096) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96JB5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.