CDC26 (NM_139286) Human Recombinant Protein

Cdc26 protein,

Product Info Summary

SKU: PROTQ8NHZ8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CDC26 (NM_139286) Human Recombinant Protein

View all Cdc26 recombinant proteins

SKU/Catalog Number

PROTQ8NHZ8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cell division cycle 26 homolog (S. cerevisiae) (CDC26)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDC26 (NM_139286) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NHZ8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.6 kDa

Amino Acid Sequence

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF

Validation Images & Assay Conditions

Gene/Protein Information For CDC26 (Source: Uniprot.org, NCBI)

Gene Name

CDC26

Full Name

Anaphase-promoting complex subunit CDC26

Weight

9.6 kDa

Superfamily

CDC26 family

Alternative Names

ANAPC12chromosome 9 open reading frame 17; Anaphase-promoting complex subunit 12; anaphase-promoting complex subunit CDC26; APC12anaphase promoting complex subunit 12; C9orf17; CDC26 subunit of anaphase promoting complex; cell division cycle 26 homolog (S. cerevisiae); cell division cycle 26; Cell division cycle protein 26 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDC26, check out the CDC26 Infographic

CDC26 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDC26: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NHZ8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDC26 (NM_139286) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDC26 (NM_139286) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDC26 (NM_139286) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NHZ8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.