CD84 (NM_003874) Human Recombinant Protein

CD84/SLAMF5 protein,

Product Info Summary

SKU: PROTQ9UIB8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CD84 (NM_003874) Human Recombinant Protein

View all CD84/SLAMF5 recombinant proteins

SKU/Catalog Number

PROTQ9UIB8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CD84 molecule (CD84)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD84 (NM_003874) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UIB8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.7 kDa

Amino Acid Sequence

MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI

Validation Images & Assay Conditions

Gene/Protein Information For CD84 (Source: Uniprot.org, NCBI)

Gene Name

CD84

Full Name

SLAM family member 5

Weight

36.7 kDa

Alternative Names

CD84 antigen (leukocyte antigen); CD84 antigen; CD84 molecule; CD84; Cell surface antigen MAX.3; DKFZp781E2378; hCD84; hly9-beta; leucocyte differentiation antigen CD84; leukocyte antigen CD84; Leukocyte differentiation antigen CD84; Ly-9B; mCD84; Signaling lymphocytic activation molecule 5; SLAM family member 5; SLAMF5; SLAMF5LY9B CD84 LY9B, SLAMF5, hCD84, mCD84 CD84 molecule SLAM family member 5|CD84 (leukocyte )|cell surface MAX.3|hly9-beta|leucocyte differentiation CD84|leukocyte CD84|leukocyte differentiation CD84|signaling lymphocytic activation molecule 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD84, check out the CD84 Infographic

CD84 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD84: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UIB8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD84 (NM_003874) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD84 (NM_003874) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD84 (NM_003874) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UIB8
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.