CD299 (CLEC4M) (NM_014257) Human Recombinant Protein

DC-SIGNR/CD299/CLEC4M protein,

Recombinant protein of human C-type lectin domain family 4, member M (CLEC4M), transcript variant 1

Product Info Summary

SKU: PROTQ9H2X3
Size: 20 µg
Source: HEK293T

Product Name

CD299 (CLEC4M) (NM_014257) Human Recombinant Protein

View all DC-SIGNR/CD299/CLEC4M recombinant proteins

SKU/Catalog Number

PROTQ9H2X3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human C-type lectin domain family 4, member M (CLEC4M), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD299 (CLEC4M) (NM_014257) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H2X3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.2 kDa

Amino Acid Sequence

MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Validation Images & Assay Conditions

Gene/Protein Information For CLEC4M (Source: Uniprot.org, NCBI)

Gene Name

CLEC4M

Full Name

C-type lectin domain family 4 member M

Weight

45.2 kDa

Alternative Names

CD209L; CD209L1; CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2; CD299 antigenMGC129964; CD299; CLEC4M; C-type lectin domain family 4, member M; DC-SIGN2; DC-SIGN2CD209 antigen-like protein 1; DCSIGNR; DC-SIGNR; DC-SIGNRDC-SIGN-related protein; DCSIGNRMGC47866; Dendritic cell-specific ICAM-3-grabbing non-integrin 2; HP10347; liver/lymph node-specific ICAM-3 grabbing non-integrin; Liver/lymph node-specific ICAM-3-grabbing non-integrin; LSIGN; L-SIGN; LSIGNC-type lectin domain family 4 member M; mannose binding C-type lectin DC-SIGNR CLEC4M CD209L, CD299, DC-SIGN2, DC-SIGNR, DCSIGNR, HP10347, L-SIGN, LSIGN C-type lectin domain family 4 member M C-type lectin domain family 4 member M|CD209 -like protein 1|CD299 |DC-SIGN-related protein|dendritic cell-specific ICAM-3-grabbing non-integrin 2|liver/lymph node-specific ICAM-3 grabbing non-integrin|mannose binding C-type lectin DC-SIGNR

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLEC4M, check out the CLEC4M Infographic

CLEC4M infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLEC4M: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H2X3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD299 (CLEC4M) (NM_014257) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD299 (CLEC4M) (NM_014257) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD299 (CLEC4M) (NM_014257) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H2X3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.