CD164 (NM_006016) Human Recombinant Protein

CD164 protein,

Product Info Summary

SKU: PROTQ04900
Size: 20 µg
Source: HEK293T

Product Name

CD164 (NM_006016) Human Recombinant Protein

View all CD164 recombinant proteins

SKU/Catalog Number

PROTQ04900

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CD164 molecule, sialomucin (CD164), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD164 (NM_006016) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ04900)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.7 kDa

Amino Acid Sequence

MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL

Validation Images & Assay Conditions

Gene/Protein Information For CD164 (Source: Uniprot.org, NCBI)

Gene Name

CD164

Full Name

Sialomucin core protein 24

Weight

20.7 kDa

Superfamily

CD164 family

Alternative Names

CD164 antigen; CD164 molecule, sialomucin; CD164; Endolyn; MGC-24; MGC-24v; MUC-24; Multi-glycosylated core protein 24; sialomucin CD164 DFNA66, MGC-24, MGC-24v, MUC-24, endolyn CD164 molecule sialomucin core protein 24|CD164 , sialomucin|multi-glycosylated core protein 24

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD164, check out the CD164 Infographic

CD164 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD164: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ04900

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD164 (NM_006016) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD164 (NM_006016) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD164 (NM_006016) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ04900
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.