CCDC134 (NM_024821) Human Recombinant Protein

Ccdc134 protein,

Recombinant protein of human coiled-coil domain containing 134 (CCDC134)

Product Info Summary

SKU: PROTQ9H6E4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CCDC134 (NM_024821) Human Recombinant Protein

View all Ccdc134 recombinant proteins

SKU/Catalog Number

PROTQ9H6E4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coiled-coil domain containing 134 (CCDC134)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CCDC134 (NM_024821) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H6E4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.4 kDa

Amino Acid Sequence

MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL

Validation Images & Assay Conditions

Gene/Protein Information For CCDC134 (Source: Uniprot.org, NCBI)

Gene Name

CCDC134

Full Name

Coiled-coil domain-containing protein 134

Weight

26.4 kDa

Superfamily

CCDC134 family

Alternative Names

CCDC134; coiled-coil domain containing 134; coiled-coil domain-containing protein 134; dJ821D11.3; FLJ22349; MGC21013

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCDC134, check out the CCDC134 Infographic

CCDC134 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCDC134: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H6E4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCDC134 (NM_024821) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCDC134 (NM_024821) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCDC134 (NM_024821) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H6E4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.