CART (CARTPT) (NM_004291) Human Recombinant Protein

CART/CARTPT protein,

Recombinant protein of human CART prepropeptide (CARTPT)

Product Info Summary

SKU: PROTQ16568
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CART (CARTPT) (NM_004291) Human Recombinant Protein

View all CART/CARTPT recombinant proteins

SKU/Catalog Number

PROTQ16568

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CART prepropeptide (CARTPT)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CART (CARTPT) (NM_004291) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16568)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.9 kDa

Amino Acid Sequence

MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

Validation Images & Assay Conditions

Gene/Protein Information For CARTPT (Source: Uniprot.org, NCBI)

Gene Name

CARTPT

Full Name

Cocaine- and amphetamine-regulated transcript protein

Weight

9.9 kDa

Superfamily

CART family

Alternative Names

CART prepropeptide; CART; CARTcocaine and amphetamine regulated transcript; CARTPT; cocaine- and amphetamine-regulated transcript protein CARTPT CART CART prepropeptide cocaine- and amphetamine-regulated transcript protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CARTPT, check out the CARTPT Infographic

CARTPT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CARTPT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16568

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CART (CARTPT) (NM_004291) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CART (CARTPT) (NM_004291) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CART (CARTPT) (NM_004291) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16568
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.