Caldesmon (CALD1) (NM_033157) Human Recombinant Protein

Caldesmon/CALD1 protein,

Recombinant protein of human caldesmon 1 (CALD1), transcript variant 3

Product Info Summary

SKU: PROTQ05682
Size: 20 µg
Source: HEK293T

Product Name

Caldesmon (CALD1) (NM_033157) Human Recombinant Protein

View all Caldesmon/CALD1 recombinant proteins

SKU/Catalog Number

PROTQ05682

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human caldesmon 1 (CALD1), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Caldesmon (CALD1) (NM_033157) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ05682)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

65.4 kDa

Amino Acid Sequence

MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV

Validation Images & Assay Conditions

Gene/Protein Information For CALD1 (Source: Uniprot.org, NCBI)

Gene Name

CALD1

Full Name

Caldesmon

Weight

65.4 kDa

Superfamily

caldesmon family

Alternative Names

CAD; CALD1; caldesmon 1; Caldesmon; CDM; CDMH-CAD; HCAD; LCAD; L-CAD; MGC21352; NAG22 CALD1 CDM, H-CAD, HCAD, L-CAD, LCAD, NAG22 caldesmon 1 caldesmon|testis secretory sperm-binding protein Li 227n

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CALD1, check out the CALD1 Infographic

CALD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CALD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ05682

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Caldesmon (CALD1) (NM_033157) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Caldesmon (CALD1) (NM_033157) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Caldesmon (CALD1) (NM_033157) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ05682
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.