CA12 (NM_001218) Human Recombinant Protein

Carbonic Anhydrase XII/CA12 protein,

Product Info Summary

SKU: PROTO43570
Size: 20 µg
Source: HEK293T

Product Name

CA12 (NM_001218) Human Recombinant Protein

View all Carbonic Anhydrase XII/CA12 recombinant proteins

SKU/Catalog Number

PROTO43570

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carbonic anhydrase XII (CA12), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CA12 (NM_001218) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43570)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.8 kDa

Amino Acid Sequence

MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA

Validation Images & Assay Conditions

Gene/Protein Information For CA12 (Source: Uniprot.org, NCBI)

Gene Name

CA12

Full Name

Carbonic anhydrase 12

Weight

36.8 kDa

Superfamily

alpha-carbonic anhydrase family

Alternative Names

CA12; Carbonate dehydratase XII; carbonic anhydrase 12; Carbonic Anhydrase XII; carbonic anhydrase XIICAXII; carbonic dehydratase; CA-XII; EC 4.2.1.1; FLJ20151; HsT18816; Tumor antigen HOM-RCC-3.1.3 CA12 CA-XII, CAXII, HsT18816, T18816 carbonic anhydrase 12 carbonic anhydrase 12|carbonate dehydratase XII|carbonic anhydrase XII|carbonic dehydratase|tumor HOM-RCC-3.1.3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CA12, check out the CA12 Infographic

CA12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CA12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43570

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CA12 (NM_001218) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CA12 (NM_001218) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CA12 (NM_001218) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43570
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.