C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein

RTRAF protein,

Recombinant protein of human chromosome 14 open reading frame 166 (C14orf166)

Product Info Summary

SKU: PROTQ9Y224
Size: 20 µg
Source: HEK293T

Product Name

C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein

View all RTRAF recombinant proteins

SKU/Catalog Number

PROTQ9Y224

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 14 open reading frame 166 (C14orf166)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y224)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.9 kDa

Amino Acid Sequence

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Validation Images & Assay Conditions

Gene/Protein Information For RTRAF (Source: Uniprot.org, NCBI)

Gene Name

RTRAF

Full Name

RNA transcription, translation and transport factor protein

Weight

27.9 kDa

Superfamily

RTRAF family

Alternative Names

RNA transcription, translation and transport factor protein RTRAF C14orf166, CGI-99, CGI99, CLE, CLE7, LCRP369, RLLM1, hCLE, hCLE1 RNA transcription, translation and transport factor RNA transcription, translation and transport factor protein|CLE7 homolog|RLL motif containing 1|UPF0568 protein C14orf166

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RTRAF, check out the RTRAF Infographic

RTRAF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RTRAF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y224

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y224
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product