BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein

BRUNOL5 protein,

Recombinant protein of human bruno-like 5, RNA binding protein (Drosophila) (BRUNOL5)

Product Info Summary

SKU: PROTQ8N6W0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein

View all BRUNOL5 recombinant proteins

SKU/Catalog Number

PROTQ8N6W0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human bruno-like 5, RNA binding protein (Drosophila) (BRUNOL5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N6W0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.2 kDa

Amino Acid Sequence

MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY

Validation Images & Assay Conditions

Gene/Protein Information For CELF5 (Source: Uniprot.org, NCBI)

Gene Name

CELF5

Full Name

CUGBP Elav-like family member 5

Weight

52.2 kDa

Superfamily

CELF/BRUNOL family

Alternative Names

Bruno (Drosophila) -like 5, RNA binding protein; BRUNOL-5; BRUNOL5bruno-like 5, RNA binding protein (Drosophila); bruno-like 5 RNA binding protein; Bruno-like protein 5; CELF-5; CUG-BP and ETR-3 like factor 5; CUG-BP- and ETR-3-like factor 5; CUGBP Elav-like family member 5; CUGBP, Elav-like family member 5; RNA-binding protein BRUNOL-5 CELF5 BRUNOL-5, BRUNOL5, CELF-5 CUGBP Elav-like family member 5 CUGBP Elav-like family member 5|CUG-BP and ETR-3 like factor 5|RNA-binding protein BRUNOL-5|bruno-like 5 RNA binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CELF5, check out the CELF5 Infographic

CELF5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CELF5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N6W0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N6W0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.