BRN4 (POU3F4) (NM_000307) Human Recombinant Protein

BRN4 protein,

Recombinant protein of human POU class 3 homeobox 4 (POU3F4)

Product Info Summary

SKU: PROTP49335
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BRN4 (POU3F4) (NM_000307) Human Recombinant Protein

View all BRN4 recombinant proteins

SKU/Catalog Number

PROTP49335

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human POU class 3 homeobox 4 (POU3F4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BRN4 (POU3F4) (NM_000307) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP49335)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.2 kDa

Amino Acid Sequence

MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL

Validation Images & Assay Conditions

Gene/Protein Information For POU3F4 (Source: Uniprot.org, NCBI)

Gene Name

POU3F4

Full Name

POU domain, class 3, transcription factor 4

Weight

39.2 kDa

Superfamily

POU transcription factor family

Alternative Names

brain-specific homeobox/POU domain protein 4; octamer-binding transcription factor 9; OTF9; POU class 3 homeobox 4; POU domain, class 3, transcription factor 4 POU3F4 BRAIN-4, BRN-4, BRN4, DFN3, DFNX2, OCT-9, OTF-9, OTF9 POU class 3 homeobox 4 POU domain, class 3, transcription factor 4|brain-specific homeobox/POU domain protein 4|octamer-binding transcription factor 9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POU3F4, check out the POU3F4 Infographic

POU3F4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POU3F4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP49335

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BRN4 (POU3F4) (NM_000307) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BRN4 (POU3F4) (NM_000307) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BRN4 (POU3F4) (NM_000307) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP49335
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.