BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

BMP-7 protein, Human

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP18075
Size: 2ug, 10ug, 1mg
Origin Species: Human
Source: Nicotiana benthamiana plant

Product Name

BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

View all BMP-7 recombinant proteins

SKU/Catalog Number

PROTP18075

Size

2ug, 10ug, 1mg

Description

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18075)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Purity

Greater than 97.0% as determined by SDS-PAGE.

Predicted MW

49.313kDa

Reconstitution

Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.

Amino Acid Sequence

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH

Biological Activity

The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Reconstitution

Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.

Validation Images & Assay Conditions

Gene/Protein Information For BMP7 (Source: Uniprot.org, NCBI)

Gene Name

BMP7

Full Name

Bone morphogenetic protein 7

Weight

49.313kDa

Superfamily

TGF-beta family

Alternative Names

Osteogenic Protein 1; BMP-7 BMP7 OP-1 bone morphogenetic protein 7 bone morphogenetic protein 7|osteogenic protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BMP7, check out the BMP7 Infographic

BMP7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BMP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP18075

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

Size

Total: $250

SKU:PROTP18075

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP18075
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.