Product Info Summary
SKU: | PROTP18075 |
---|---|
Size: | 2ug, 10ug, 1mg |
Origin Species: | Human |
Source: | Nicotiana benthamiana plant |
Customers Who Bought This Also Bought
Product info
Product Name
BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant
View all BMP-7 recombinant proteins
SKU/Catalog Number
PROTP18075
Size
2ug, 10ug, 1mg
Description
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Cite This Product
BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18075)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Purity
Greater than 97.0% as determined by SDS-PAGE.
Predicted MW
49.313kDa
Reconstitution
Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.
Amino Acid Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH
Biological Activity
The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Assay dilution & Images
Reconstitution
Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For BMP7 (Source: Uniprot.org, NCBI)
Gene Name
BMP7
Full Name
Bone morphogenetic protein 7
Weight
49.313kDa
Superfamily
TGF-beta family
Alternative Names
Osteogenic Protein 1; BMP-7 BMP7 OP-1 bone morphogenetic protein 7 bone morphogenetic protein 7|osteogenic protein 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on BMP7, check out the BMP7 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BMP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant (PROTP18075)
Hello CJ!
No publications found for PROTP18075
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question