BLAP75 (RMI1) (NM_024945) Human Recombinant Protein

BLAP75 protein,

Purified recombinant protein of Homo sapiens RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) (RMI1)

Product Info Summary

SKU: PROTQ9H9A7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BLAP75 (RMI1) (NM_024945) Human Recombinant Protein

View all BLAP75 recombinant proteins

SKU/Catalog Number

PROTQ9H9A7

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) (RMI1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BLAP75 (RMI1) (NM_024945) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H9A7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

70 kDa

Amino Acid Sequence

MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

Validation Images & Assay Conditions

Gene/Protein Information For RMI1 (Source: Uniprot.org, NCBI)

Gene Name

RMI1

Full Name

RecQ-mediated genome instability protein 1

Weight

70 kDa

Superfamily

RMI1 family

Alternative Names

75 kDa; BLM-associated protein 75 kDa; BLM-associated protein of 75 kDa; chromosome 9 open reading frame 76; FAAP75; FLJ12888; homolog of yeast RecQ-mediated genome instability 1 (RMI1); recQ-mediated genome instability protein 1; RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae); RMI2 Rmi1|4932432N11Rik, C79893|RecQ mediated genome instability 1|recQ-mediated genome instability protein 1|RMI1, RecQ mediated genome instability 1, homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RMI1, check out the RMI1 Infographic

RMI1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RMI1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H9A7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BLAP75 (RMI1) (NM_024945) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BLAP75 (RMI1) (NM_024945) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BLAP75 (RMI1) (NM_024945) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H9A7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.