beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein

beta 2-Microglobulin protein,

Product Info Summary

SKU: PROTP61769
Size: 20 µg
Source: HEK293T

Product Name

beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein

View all beta 2-Microglobulin recombinant proteins

SKU/Catalog Number

PROTP61769

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human beta-2-microglobulin (B2M)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61769)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.7 kDa

Amino Acid Sequence

MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Validation Images & Assay Conditions

Gene/Protein Information For B2M (Source: Uniprot.org, NCBI)

Gene Name

B2M

Full Name

Beta-2-microglobulin

Weight

11.7 kDa

Superfamily

beta-2-microglobulin family

Alternative Names

B2M; beta 2Microglobulin; beta 2-Microglobulin; beta chain of MHC class I molecules; beta-2-microglobin; beta-2-microglobulin B2M IMD43 beta-2-microglobulin beta-2-microglobulin|beta chain of MHC class I molecules|beta-2-microglobin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on B2M, check out the B2M Infographic

B2M infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for B2M: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61769

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61769
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.