Bcl G (BCL2L14) (NM_138722) Human Recombinant Protein

Bcl G protein,

Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1

Product Info Summary

SKU: PROTQ9BZR8
Size: 20 µg
Source: HEK293T

Product Name

Bcl G (BCL2L14) (NM_138722) Human Recombinant Protein

View all Bcl G recombinant proteins

SKU/Catalog Number

PROTQ9BZR8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Bcl G (BCL2L14) (NM_138722) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BZR8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.4 kDa

Amino Acid Sequence

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

Validation Images & Assay Conditions

Gene/Protein Information For Bcl2l14 (Source: Uniprot.org, NCBI)

Gene Name

Bcl2l14

Full Name

Apoptosis facilitator Bcl-2-like protein 14

Weight

36.4 kDa

Superfamily

Bcl-2 family

Alternative Names

apoptosis facilitator Bcl-2-like protein 14; Apoptosis regulator Bcl-G; Bcl2-L-14; BCL2-like 14 (apoptosis facilitator); BCL-G; BCLGbcl2-L-14 Bcl2l14|4930452K23Rik, 4933405K19Rik, 9030625M01Rik, AI429211, Bcl-G, Bclg|BCL2-like 14 (apoptosis facilitator)|apoptosis facilitator Bcl-2-like protein 14|apoptosis regulator BCL-G

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Bcl2l14, check out the Bcl2l14 Infographic

Bcl2l14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Bcl2l14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BZR8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Bcl G (BCL2L14) (NM_138722) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Bcl G (BCL2L14) (NM_138722) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Bcl G (BCL2L14) (NM_138722) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BZR8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.