BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein

BAFFR/TNFRSF13C protein, Human

B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E. coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ96RJ3
Size: 10ug, 50ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein

View all BAFFR/TNFRSF13C recombinant proteins

SKU/Catalog Number

PROTQ96RJ3

Size

10ug, 50ug, 1mg

Description

B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E. coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Cite This Product

BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96RJ3)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.

Purity

Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Predicted MW

18.798kDa

Reconstitution

It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG ASSPAPRTALQPQESVGAGAGEAALPLPG

Biological Activity

Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.

Reconstitution

It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For TNFRSF13C (Source: Uniprot.org, NCBI)

Gene Name

TNFRSF13C

Full Name

Tumor necrosis factor receptor superfamily member 13C

Weight

18.798kDa

Alternative Names

TNFRSF13C; CD268; BAFF-R; MGC138235; B cell-activating factor receptor Tnfrsf13c|2010006P15Rik, BAFF, BAFF-R, Baf, Baffr, Bcmd, Bcmd-1, Bcmd1, Lv, Lvis22|tumor necrosis factor receptor superfamily, member 13c|tumor necrosis factor receptor superfamily member 13C|B-cell maturation defect 1|B-cell-activating factor receptor|BAFF receptor|BLyS receptor 3|b cell-activating factor receptor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFRSF13C, check out the TNFRSF13C Infographic

TNFRSF13C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFRSF13C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96RJ3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein

Size

Total: $250

SKU:PROTQ96RJ3

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ96RJ3
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.