Product Info Summary
SKU: | PROTQ96RJ3 |
---|---|
Size: | 10ug, 50ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein
View all BAFFR/TNFRSF13C recombinant proteins
SKU/Catalog Number
PROTQ96RJ3
Size
10ug, 50ug, 1mg
Description
B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E. coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Cite This Product
BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96RJ3)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Purity
Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
18.798kDa
Reconstitution
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG ASSPAPRTALQPQESVGAGAGEAALPLPG
Biological Activity
Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For TNFRSF13C (Source: Uniprot.org, NCBI)
Gene Name
TNFRSF13C
Full Name
Tumor necrosis factor receptor superfamily member 13C
Weight
18.798kDa
Alternative Names
TNFRSF13C; CD268; BAFF-R; MGC138235; B cell-activating factor receptor Tnfrsf13c|2010006P15Rik, BAFF, BAFF-R, Baf, Baffr, Bcmd, Bcmd-1, Bcmd1, Lv, Lvis22|tumor necrosis factor receptor superfamily, member 13c|tumor necrosis factor receptor superfamily member 13C|B-cell maturation defect 1|B-cell-activating factor receptor|BAFF receptor|BLyS receptor 3|b cell-activating factor receptor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFRSF13C, check out the TNFRSF13C Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFRSF13C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein (PROTQ96RJ3)
Hello CJ!
No publications found for PROTQ96RJ3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question