ASC2 (PYDC1) (NM_152901) Human Recombinant Protein

ASC2 protein,

Recombinant protein of human PYD (pyrin domain) containing 1 (PYDC1)

Product Info Summary

SKU: PROTQ8WXC3
Size: 20 µg
Source: HEK293T

Product Name

ASC2 (PYDC1) (NM_152901) Human Recombinant Protein

View all ASC2 recombinant proteins

SKU/Catalog Number

PROTQ8WXC3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PYD (pyrin domain) containing 1 (PYDC1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ASC2 (PYDC1) (NM_152901) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WXC3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.9 kDa

Amino Acid Sequence

MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA

Validation Images & Assay Conditions

Gene/Protein Information For PYDC1 (Source: Uniprot.org, NCBI)

Gene Name

PYDC1

Full Name

Pyrin domain-containing protein 1

Weight

9.9 kDa

Alternative Names

ASC2PAAD-only protein 1; ASCI; POP1pyrin domain-containing protein 1; PYC1; PYD (pyrin domain) containing 1; pyrin domain containing 1; pyrin-domain containing protein 1; Pyrin-only protein 1 PYDC1 ASC2, POP1, PYC1, cPOP1 pyrin domain containing 1 pyrin domain-containing protein 1|PAAD-only protein 1|PYD (pyrin domain) containing 1|cellular POP1|pyrin-only protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PYDC1, check out the PYDC1 Infographic

PYDC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PYDC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WXC3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ASC2 (PYDC1) (NM_152901) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ASC2 (PYDC1) (NM_152901) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ASC2 (PYDC1) (NM_152901) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WXC3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.