APOBEC2 (NM_006789) Human Recombinant Protein

APOBEC2 protein,

Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2)

Product Info Summary

SKU: PROTQ9Y235
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

APOBEC2 (NM_006789) Human Recombinant Protein

View all APOBEC2 recombinant proteins

SKU/Catalog Number

PROTQ9Y235

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

APOBEC2 (NM_006789) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y235)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.5 kDa

Amino Acid Sequence

MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK

Validation Images & Assay Conditions

Gene/Protein Information For APOBEC2 (Source: Uniprot.org, NCBI)

Gene Name

APOBEC2

Full Name

C->U-editing enzyme APOBEC-2

Weight

25.5 kDa

Superfamily

cytidine and deoxycytidylate deaminase family

Alternative Names

apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; ARCD1; ARP1; EC 3.5.4; EC 3.5.4.-; probable C->U-editing enzyme APOBEC-2 APOBEC2 ARCD1, ARP1 apolipoprotein B mRNA editing enzyme catalytic subunit 2 C->U-editing enzyme APOBEC-2|apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2|apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2|mRNA(cytosine(6666)) deaminase 2|probable C->U-editing enzyme APOBEC-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on APOBEC2, check out the APOBEC2 Infographic

APOBEC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for APOBEC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y235

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used APOBEC2 (NM_006789) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For APOBEC2 (NM_006789) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for APOBEC2 (NM_006789) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y235
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.