Click image to see more details
Product Info Summary
| SKU: | A03543-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ZP3 Antibody Picoband®
SKU/Catalog Number
A03543-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ZP3 Antibody Picoband® catalog # A03543-1. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ZP3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03543-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ZP3, which shares 77.4% amino acid (aa) sequence identity with both mouse and rat ZP3.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A03543-1 is reactive to ZP3 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
47 kDa
Calculated molecular weight
75187 MW
Background of ZP3
Zona pellucida sperm-binding protein 3, also known as zona pellucida glycoprotein 3 (Zp-3) or the sperm receptor, is a ZP module-containing protein that in humans is encoded by the ZP3 gene. It is mapped to 7q11.23. he zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A03543-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human MCF-7 whole cell, human A549 whole cell, human Hela whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ZP3 using anti-ZP3 antibody (A03543-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human MCF-7 whole cell lysates,
Lane 2: human A549 whole cell lysates,
Lane 3: human Hela whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ZP3 antigen affinity purified polyclonal antibody (Catalog # A03543-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ZP3 at approximately 47 kDa. The expected band size for ZP3 is at 47 kDa.
Protein Target Info & Infographic
Gene/Protein Information For ZP3 (Source: Uniprot.org, NCBI)
Gene Name
ZP3
Full Name
Zona pellucida sperm-binding protein 3
Weight
75187 MW
Superfamily
ZP domain family
Alternative Names
Zona pellucida sperm-binding protein 3; Sperm receptor; ZP3A/ZP3B; Zona pellucida glycoprotein 3; Zp-3; Zona pellucida protein C; ZP3; ZP3A; ZP3B; ZPC ZP3 OOMD3A, ZP3B, ZPC, Zp-3, ZP3 zona pellucida glycoprotein 3 zona pellucida sperm-binding protein 3|ZP3A/ZP3B|sperm receptor|zona pellucida glycoprotein 3B|zona pellucida glycoprotein ZP3|zona pellucida protein C
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ZP3, check out the ZP3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ZP3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ZP3 Antibody Picoband® (A03543-1)
Hello CJ!
No publications found for A03543-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ZP3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ZP3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-ZP3 Antibody Picoband®
Question
Is a blocking peptide available for product anti-ZP3 antibody (A03543-1)?
Verified Customer
Verified customer
Asked: 2020-02-21
Answer
We do provide the blocking peptide for product anti-ZP3 antibody (A03543-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-02-21
Question
Our lab were content with the WB result of your anti-ZP3 antibody. However we have seen positive staining in lung processed zona pellucida sperm-binding using this antibody. Is that expected? Could you tell me where is ZP3 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-02-11
Answer
Based on literature, lung does express ZP3. Generally ZP3 expresses in processed zona pellucida sperm-binding, cell membrane. Regarding which tissues have ZP3 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Lung, Pubmed ID: 14702039
Ovary, Pubmed ID: 1478648
Boster Scientific Support
Answered: 2020-02-11
Question
Does anti-ZP3 antibody A03543-1 work for WB with brain?
Verified Customer
Verified customer
Asked: 2020-01-21
Answer
According to the expression profile of brain, ZP3 is highly expressed in brain. So, it is likely that anti-ZP3 antibody A03543-1 will work for WB with brain.
Boster Scientific Support
Answered: 2020-01-21
Question
We are currently using anti-ZP3 antibody A03543-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-02
Answer
The anti-ZP3 antibody (A03543-1) has not been validated for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-02
Question
I have a question about product A03543-1, anti-ZP3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-11-07
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03543-1 anti-ZP3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-11-07
Question
I am looking for to test anti-ZP3 antibody A03543-1 on human brain for research purposes, then I may be interested in using anti-ZP3 antibody A03543-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-09-13
Answer
The products we sell, including anti-ZP3 antibody A03543-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-09-13
Question
Here is the WB image, lot number and protocol we used for brain using anti-ZP3 antibody A03543-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-08-19
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-19
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-ZP3 antibody A03543-1. Let me know if you need anything else.
E. Banerjee
Verified customer
Asked: 2019-04-09
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-04-09
Question
Do you have a BSA free version of anti-ZP3 antibody A03543-1 available?
D. Roberts
Verified customer
Asked: 2018-06-06
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ZP3 antibody A03543-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-06-06
Question
We have observed staining in human ovary. What should we do? Is anti-ZP3 antibody supposed to stain ovary positively?
Verified Customer
Verified customer
Asked: 2018-05-02
Answer
From literature ovary does express ZP3. From Uniprot.org, ZP3 is expressed in lower esophagus mucosa, ovary, lung, brain, among other tissues. Regarding which tissues have ZP3 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Lung, Pubmed ID: 14702039
Ovary, Pubmed ID: 1478648
Boster Scientific Support
Answered: 2018-05-02
Question
I am interested in using your anti-ZP3 antibody for negative regulation of binding of sperm to zona pellucida studies. Has this antibody been tested with western blotting on human placenta tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2018-02-22
Answer
We appreciate your inquiry. This A03543-1 anti-ZP3 antibody is validated on human placenta tissue, hela whole cell lysates, a549 whole cell lysates, u2os whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-02-22
Question
I was wanting to use your anti-ZP3 antibody for WB for human brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2018-01-19
Answer
As indicated on the product datasheet, A03543-1 anti-ZP3 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-01-19
Question
Is this A03543-1 anti-ZP3 antibody reactive to the isotypes of ZP3?
C. Johnson
Verified customer
Asked: 2015-12-15
Answer
The immunogen of A03543-1 anti-ZP3 antibody is A synthetic peptide corresponding to a sequence of human ZP3(LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2015-12-15
Question
I see that the anti-ZP3 antibody A03543-1 works with WB, what is the protocol used to produce the result images on the product page?
R. Carter
Verified customer
Asked: 2014-02-28
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-02-28
Question
Would A03543-1 anti-ZP3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
R. Evans
Verified customer
Asked: 2013-09-04
Answer
You can see on the product datasheet, A03543-1 anti-ZP3 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-09-04
