Product Info Summary
SKU: | PB9839 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-UBE2Q2 Antibody Picoband™
SKU/Catalog Number
PB9839
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-UBE2Q2 Antibody Picoband™ catalog # PB9839. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-UBE2Q2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9839)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2, different from the related mouse sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9839 is reactive to UBE2Q2 in Human
Applications
PB9839 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
50 kDa
Calculated molecular weight
42818 MW
Background of UBE2Q2
UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. UBE2Q2 can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
![pb9839 1 WB anti ube2q2 picoband antibody pb9839 1 WB anti ube2q2 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9839-1-WB-anti-ube2q2-picoband-antibody.jpg)
Click image to see more details
Figure 1. Western blot analysis of UBE2Q2 using anti-UBE2Q2 antibody (PB9839).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40 ug of sample under reducing conditions.
Lane 1: HELA whole cell lysates,
Lane 2: A431 whole cell lysates,
Lane 3: MCF-7 whole cell lysates,
Lane 4: SW620 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-UBE2Q2 antigen affinity purified polyclonal antibody (Catalog # PB9839) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for UBE2Q2 at approximately 50 kDa. The expected band size for UBE2Q2 is at 50 kDa.
![pb9839 2 IHC anti ube2q2 picoband antibody pb9839 2 IHC anti ube2q2 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9839-2-IHC-anti-ube2q2-picoband-antibody.jpg)
Click image to see more details
Figure 2. IHC analysis of UBE2Q2 using anti-UBE2Q2 antibody (PB9839).
UBE2Q2 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-UBE2Q2 Antibody (PB9839) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
![pb9839 ube2q2 primary antibodies if testing 3 pb9839 ube2q2 primary antibodies if testing 3](https://www.bosterbio.com/media/catalog/product/p/b/pb9839-ube2q2-primary-antibodies-if-testing-3.jpg)
Click image to see more details
Figure 3. IF analysis of UBE2Q2 using anti-UBE2Q2 antibody (PB9839).
UBE2Q2 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-UBE2Q2 Antibody (PB9839) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
![pb9839 ube2q2 primary antibodies fcm testing 4 pb9839 ube2q2 primary antibodies fcm testing 4](https://www.bosterbio.com/media/catalog/product/p/b/pb9839-ube2q2-primary-antibodies-fcm-testing-4.jpg)
Click image to see more details
Figure 4. Flow Cytometry analysis of A549 cells using anti-UBE2Q2 antibody (PB9839).
Overlay histogram showing A549 cells stained with PB9839 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-UBE2Q2 Antibody (PB9839,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For UBE2Q2 (Source: Uniprot.org, NCBI)
Gene Name
UBE2Q2
Full Name
Ubiquitin-conjugating enzyme E2 Q2
Weight
42818 MW
Superfamily
ubiquitin-conjugating enzyme family
Alternative Names
DKFZp762C143; EC 6.3.2.19; LOC92912; UBE2Q2; Ubiquitin carrier protein Q2; ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q (putative) 2; ubiquitin-conjugating enzyme E2Q family member 2; Ubiquitin-protein ligase Q2 UBE2Q2 ubiquitin conjugating enzyme E2 Q2 ubiquitin-conjugating enzyme E2 Q2|E2 ubiquitin-conjugating enzyme Q2|ubiquitin carrier protein Q2|ubiquitin conjugating enzyme E2Q family member 2|ubiquitin-protein ligase Q2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on UBE2Q2, check out the UBE2Q2 Infographic
![UBE2Q2 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for UBE2Q2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-UBE2Q2 Antibody Picoband™ (PB9839)
Hello CJ!
No publications found for PB9839
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-UBE2Q2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-UBE2Q2 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-UBE2Q2 Antibody Picoband™
Question
Is a blocking peptide available for product anti-UBE2Q2 antibody (PB9839)?
Verified Customer
Verified customer
Asked: 2020-03-09
Answer
We do provide the blocking peptide for product anti-UBE2Q2 antibody (PB9839). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-03-09
Question
See below the WB image, lot number and protocol we used for secondary oocyte using anti-UBE2Q2 antibody PB9839. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-12-10
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-10
Question
We are interested in to test anti-UBE2Q2 antibody PB9839 on human secondary oocyte for research purposes, then I may be interested in using anti-UBE2Q2 antibody PB9839 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-10-30
Answer
The products we sell, including anti-UBE2Q2 antibody PB9839, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-10-30
Question
Is this PB9839 anti-UBE2Q2 antibody reactive to the isotypes of UBE2Q2?
J. Li
Verified customer
Asked: 2018-03-01
Answer
The immunogen of PB9839 anti-UBE2Q2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-03-01
Question
We are currently using anti-UBE2Q2 antibody PB9839 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2017-09-29
Answer
The anti-UBE2Q2 antibody (PB9839) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-09-29
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for secondary oocyte using anti-UBE2Q2 antibody PB9839. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2017-06-20
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-06-20
Question
Does anti-UBE2Q2 antibody PB9839 work for IHC with secondary oocyte?
L. Jones
Verified customer
Asked: 2015-06-23
Answer
According to the expression profile of secondary oocyte, UBE2Q2 is highly expressed in secondary oocyte. So, it is likely that anti-UBE2Q2 antibody PB9839 will work for IHC with secondary oocyte.
Boster Scientific Support
Answered: 2015-06-23