Product Info Summary
SKU: | PB9449 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Mouse, Rat |
Host: | Rabbit |
Application: | IF, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Tyrosine Hydroxylase/TH Antibody Picoband®
View all Tyrosine Hydroxylase Antibodies
SKU/Catalog Number
PB9449
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband® catalog # PB9449. Tested in IF, IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Tyrosine Hydroxylase/TH Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9449)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9449 is reactive to TH in Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
59 kDa
Calculated molecular weight
58600 MW
Background of Tyrosine Hydroxylase
TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9449 is guaranteed for IF, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Mouse, Rat, By Heat
Immunofluorescence, 5μg/ml, Mouse, Rat
Positive Control
WB: rat brain tissue, mouse brain tissue
IHC: mouse brain tissue, rat brain tissue
IF: mouse brian tissue, rat brian tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody (PB9449).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Tyrosine Hydroxylase/TH antigen affinity purified polyclonal antibody (Catalog # PB9449) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Tyrosine Hydroxylase/TH at approximately 59 kDa. The expected band size for Tyrosine Hydroxylase/TH is at 59 kDa.
Click image to see more details
Figure 2. IHC analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody (PB9449).
Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Tyrosine Hydroxylase/TH Antibody (PB9449) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody (PB9449).
Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Tyrosine Hydroxylase/TH Antibody (PB9449) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 4. IF analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody (PB9449).
Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of mouse brian tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 μg/mL rabbit anti-Tyrosine Hydroxylase/TH Antibody (PB9449) overnight at 4°C. Biotin conjugated goat anti-rabbit IgG (BA1003) was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using DyLight®488 Conjugated Avidin (BA1128). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 5. IF analysis of Tyrosine Hydroxylase/TH using antiTyrosine Hydroxylase/TH antibody (PB9449).
Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of rat brian tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 μg/mL rabbit anti-Tyrosine Hydroxylase/TH Antibody (PB9449) overnight at 4°C. Biotin conjugated goat anti-rabbit IgG (BA1003) was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using DyLight®488 Conjugated Avidin (BA1128). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For TH (Source: Uniprot.org, NCBI)
Gene Name
TH
Full Name
Tyrosine 3-monooxygenase
Weight
58600 MW
Superfamily
biopterin-dependent aromatic amino acid hydroxylase family
Alternative Names
Tyrosine 3-monooxygenase;1.14.16.2;Tyrosine 3-hydroxylase;TH;TH;TYH; TH DYT14, DYT5b, TYH tyrosine hydroxylase tyrosine 3-monooxygenase|dystonia 14|tyrosine 3-hydroxylase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on TH, check out the TH Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Tyrosine Hydroxylase/TH Antibody Picoband® (PB9449)
Hello CJ!
PB9449 has been cited in 23 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
PAC1 Receptor Mediates Electroacupuncture-Induced Neuro and Immune Protection During Cisplatin Chemotherapy
Age-Related Cognitive and Motor Decline in a Mouse Model of CDKL5 Deficiency Disorder is Associated with Increased Neuronal Senescence and Death
Autonomic remodeling may be responsible for decreased incidence of aortic dissection in STZ-induced diabetic rats via down-regulation of matrix metalloprotease 2
lncRNA NEAT1 prompts autophagy and apoptosis in MPTP-induced Parkinson’s disease by impairing miR-374c-5p
Neuroprotective effect of arctigenin against neuroinflammation and oxidative stress induced by rotenone
Moderate ethanol drinking is sufficient to alter Ventral Tegmental Area dopamine neurons activity via functional and structural remodeling of GABAergic transmission
Puerarin attenuates neuronal degeneration and blocks oxidative stress to elicit a neuroprotective effect on substantia nigra injury in 6-OHDA-lesioned rats
Effect of the changes of NMDA receptor in hypothalamic paraventricular nucleus on cardiac function and sympathetic nervous activity in rats with heart failure
Harpagide inhibits microglial activation and protects dopaminergic neurons as revealed by nanoelectrode amperometry
Ultra-trace graphene oxide in a water environment triggers Parkinson‘s disease-like symptoms and metabolic disturbance in zebrafish larvae
Species: Zebrafish
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Tyrosine Hydroxylase/TH Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Tyrosine Hydroxylase/TH Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Tyrosine Hydroxylase/TH Antibody Picoband®
Question
Is there a BSA free version of anti-Tyrosine Hydroxylase/TH antibody PB9449 available?
Verified Customer
Verified customer
Asked: 2020-04-03
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Tyrosine Hydroxylase/TH antibody PB9449 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-03
Question
We are currently using anti-Tyrosine Hydroxylase/TH antibody PB9449 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2020-02-28
Answer
The anti-Tyrosine Hydroxylase/TH antibody (PB9449) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-28
Question
We want using your anti-Tyrosine Hydroxylase/TH antibody for heart development studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-11-11
Answer
I appreciate your inquiry. This PB9449 anti-Tyrosine Hydroxylase/TH antibody is validated on rat brain tissue, tissue lysate, mouse brain. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-11-11
Question
Is PB9449 suitable for immunostaining of mouse long bone nerve fibers?
Verified customer
Asked: 2019-10-06
Answer
Yes, Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ (PB9449) is suitable for the immunostaining of mouse long bone nerve fibers.
Boster Scientific Support
Answered: 2019-10-09
Question
I was wanting to use your anti-Tyrosine Hydroxylase/TH antibody for WB for rat substantia nigra on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat substantia nigra identification?
Verified Customer
Verified customer
Asked: 2019-09-05
Answer
It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody has been tested for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat substantia nigra in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-05
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-07-25
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-07-25
Question
Is a blocking peptide available for product anti-Tyrosine Hydroxylase/TH antibody (PB9449)?
Verified Customer
Verified customer
Asked: 2019-06-24
Answer
We do provide the blocking peptide for product anti-Tyrosine Hydroxylase/TH antibody (PB9449). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-06-24
Question
Does PB9449 anti-Tyrosine Hydroxylase/TH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
S. Moore
Verified customer
Asked: 2019-03-26
Answer
It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-03-26
Question
Does anti-Tyrosine Hydroxylase/TH antibody PB9449 work for WB with substantia nigra?
Verified Customer
Verified customer
Asked: 2019-02-14
Answer
According to the expression profile of substantia nigra, TH is highly expressed in substantia nigra. So, it is likely that anti-Tyrosine Hydroxylase/TH antibody PB9449 will work for WB with substantia nigra.
Boster Scientific Support
Answered: 2019-02-14
Question
I have a question about product PB9449, anti-Tyrosine Hydroxylase/TH antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
H. Baker
Verified customer
Asked: 2018-09-26
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9449 anti-Tyrosine Hydroxylase/TH antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-09-26
Question
I see that the anti-Tyrosine Hydroxylase/TH antibody PB9449 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-09-07
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-09-07
Question
See below the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-06-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-28
Question
Is this PB9449 anti-Tyrosine Hydroxylase/TH antibody reactive to the isotypes of TH?
Verified Customer
Verified customer
Asked: 2018-05-16
Answer
The immunogen of PB9449 anti-Tyrosine Hydroxylase/TH antibody is A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-05-16
Question
you antibody to test anti-Tyrosine Hydroxylase/TH antibody PB9449 on rat substantia nigra for research purposes, then I may be interested in using anti-Tyrosine Hydroxylase/TH antibody PB9449 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
T. Baker
Verified customer
Asked: 2015-10-27
Answer
The products we sell, including anti-Tyrosine Hydroxylase/TH antibody PB9449, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-10-27