Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

Tyrosine Hydroxylase antibody

Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband® catalog # PB9449. Tested in IF, IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 23 publication(s).

Product Info Summary

SKU: PB9449
Size: 100 μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: IF, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

View all Tyrosine Hydroxylase Antibodies

SKU/Catalog Number

PB9449

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband® catalog # PB9449. Tested in IF, IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Tyrosine Hydroxylase/TH Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9449)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9449 is reactive to TH in Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

59 kDa

Calculated molecular weight

58600 MW

Background of Tyrosine Hydroxylase

TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9449 is guaranteed for IF, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Mouse, Rat, By Heat
Immunofluorescence, 5μg/ml, Mouse, Rat

Positive Control

WB: rat brain tissue, mouse brain tissue
IHC: mouse brain tissue, rat brain tissue
IF: mouse brian tissue, rat brian tissue

Validation Images & Assay Conditions

Gene/Protein Information For TH (Source: Uniprot.org, NCBI)

Gene Name

TH

Full Name

Tyrosine 3-monooxygenase

Weight

58600 MW

Superfamily

biopterin-dependent aromatic amino acid hydroxylase family

Alternative Names

Tyrosine 3-monooxygenase;1.14.16.2;Tyrosine 3-hydroxylase;TH;TH;TYH; TH DYT14, DYT5b, TYH tyrosine hydroxylase tyrosine 3-monooxygenase|dystonia 14|tyrosine 3-hydroxylase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on TH, check out the TH Infographic

TH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9449 has been cited in 23 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

PAC1 Receptor Mediates Electroacupuncture-Induced Neuro and Immune Protection During Cisplatin Chemotherapy

Age-Related Cognitive and Motor Decline in a Mouse Model of CDKL5 Deficiency Disorder is Associated with Increased Neuronal Senescence and Death

Autonomic remodeling may be responsible for decreased incidence of aortic dissection in STZ-induced diabetic rats via down-regulation of matrix metalloprotease 2

lncRNA NEAT1 prompts autophagy and apoptosis in MPTP-induced Parkinson’s disease by impairing miR-374c-5p

Neuroprotective effect of arctigenin against neuroinflammation and oxidative stress induced by rotenone

Moderate ethanol drinking is sufficient to alter Ventral Tegmental Area dopamine neurons activity via functional and structural remodeling of GABAergic transmission

Puerarin attenuates neuronal degeneration and blocks oxidative stress to elicit a neuroprotective effect on substantia nigra injury in 6-OHDA-lesioned rats

Effect of the changes of NMDA receptor in hypothalamic paraventricular nucleus on cardiac function and sympathetic nervous activity in rats with heart failure

Harpagide inhibits microglial activation and protects dopaminergic neurons as revealed by nanoelectrode amperometry

Ultra-trace graphene oxide in a water environment triggers Parkinson‘s disease-like symptoms and metabolic disturbance in zebrafish larvae
Species: Zebrafish

Have you used Anti-Tyrosine Hydroxylase/TH Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

Question

Is there a BSA free version of anti-Tyrosine Hydroxylase/TH antibody PB9449 available?

Verified Customer

Verified customer

Asked: 2020-04-03

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Tyrosine Hydroxylase/TH antibody PB9449 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-03

Question

We are currently using anti-Tyrosine Hydroxylase/TH antibody PB9449 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

The anti-Tyrosine Hydroxylase/TH antibody (PB9449) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-28

Question

We want using your anti-Tyrosine Hydroxylase/TH antibody for heart development studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-11-11

Answer

I appreciate your inquiry. This PB9449 anti-Tyrosine Hydroxylase/TH antibody is validated on rat brain tissue, tissue lysate, mouse brain. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-11-11

Question

Is PB9449 suitable for immunostaining of mouse long bone nerve fibers?

Verified customer

Asked: 2019-10-06

Answer

Yes, Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ (PB9449) is suitable for the immunostaining of mouse long bone nerve fibers.

Boster Scientific Support

Answered: 2019-10-09

Question

I was wanting to use your anti-Tyrosine Hydroxylase/TH antibody for WB for rat substantia nigra on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat substantia nigra identification?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody has been tested for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat substantia nigra in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-05

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-07-25

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-25

Question

Is a blocking peptide available for product anti-Tyrosine Hydroxylase/TH antibody (PB9449)?

Verified Customer

Verified customer

Asked: 2019-06-24

Answer

We do provide the blocking peptide for product anti-Tyrosine Hydroxylase/TH antibody (PB9449). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-24

Question

Does PB9449 anti-Tyrosine Hydroxylase/TH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

S. Moore

Verified customer

Asked: 2019-03-26

Answer

It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-03-26

Question

Does anti-Tyrosine Hydroxylase/TH antibody PB9449 work for WB with substantia nigra?

Verified Customer

Verified customer

Asked: 2019-02-14

Answer

According to the expression profile of substantia nigra, TH is highly expressed in substantia nigra. So, it is likely that anti-Tyrosine Hydroxylase/TH antibody PB9449 will work for WB with substantia nigra.

Boster Scientific Support

Answered: 2019-02-14

Question

I have a question about product PB9449, anti-Tyrosine Hydroxylase/TH antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

H. Baker

Verified customer

Asked: 2018-09-26

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9449 anti-Tyrosine Hydroxylase/TH antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-26

Question

I see that the anti-Tyrosine Hydroxylase/TH antibody PB9449 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-09-07

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-09-07

Question

See below the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-06-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-28

Question

Is this PB9449 anti-Tyrosine Hydroxylase/TH antibody reactive to the isotypes of TH?

Verified Customer

Verified customer

Asked: 2018-05-16

Answer

The immunogen of PB9449 anti-Tyrosine Hydroxylase/TH antibody is A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-05-16

Question

you antibody to test anti-Tyrosine Hydroxylase/TH antibody PB9449 on rat substantia nigra for research purposes, then I may be interested in using anti-Tyrosine Hydroxylase/TH antibody PB9449 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

T. Baker

Verified customer

Asked: 2015-10-27

Answer

The products we sell, including anti-Tyrosine Hydroxylase/TH antibody PB9449, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-10-27

Order DetailsPrice
PB9449

100μg

$370
PB9449-10ug

10μg sample (liquid)

$99
PB9449-Biotin

100 μg Biotin conjugated

$570
PB9449-Cy3

100 μg Cy3 conjugated

$570
PB9449-Dylight488

100 μg Dylight488 conjugated

$570
PB9449-Dylight550

100 μg Dylight550 conjugated

$570
PB9449-Dylight594

100 μg Dylight594 conjugated

$570
PB9449-FITC

100 μg FITC conjugated

$570
PB9449-HRP

100 μg HRP conjugated

$570
PB9449-APC

100 μg APC conjugated

$670
PB9449-PE

100 μg PE conjugated

$670
PB9449-iFluor647

100 μg iFluor647 conjugated

$670
PB9449-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9449
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.