Anti-TMEM107 Antibody Picoband®

Tmem107 antibody

Boster Bio Anti-TMEM107 Antibody Picoband® catalog # A04966. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A04966
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Product Name

Anti-TMEM107 Antibody Picoband®

View all Tmem107 Antibodies

SKU/Catalog Number

A04966

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TMEM107 Antibody Picoband® catalog # A04966. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TMEM107 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04966)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107, different from the related mouse and rat sequences by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04966 is reactive to TMEM107 in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

22 kDa

Calculated molecular weight

15503 MW

Background of Tmem107

Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of theTMEM107 sequence with the genomic sequence (GRCh38), the TMEM107 gene was mapped to chromosome 17p13.1.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A04966 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: MCF-7 whole cell
IHC: human intestinal cancer tissue, human lung cancer tissue
FCM: A431 cell

Validation Images & Assay Conditions

Gene/Protein Information For TMEM107 (Source: Uniprot.org, NCBI)

Gene Name

TMEM107

Full Name

Transmembrane protein 107

Weight

15503 MW

Alternative Names

Transmembrane protein 107;TMEM107;DC20, UNQ638/PRO1268;

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on TMEM107, check out the TMEM107 Infographic

TMEM107 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM107: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04966

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TMEM107 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-TMEM107 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-TMEM107 Antibody Picoband®

Question

Is this A04966 anti-TMEM107 antibody reactive to the isotypes of TMEM107?

Verified Customer

Verified customer

Asked: 2020-01-06

Answer

The immunogen of A04966 anti-TMEM107 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-06

Question

We are currently using anti-TMEM107 antibody A04966 for human tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-27

Answer

The anti-TMEM107 antibody (A04966) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-27

Question

Here is the WB image, lot number and protocol we used for right uterine tube using anti-TMEM107 antibody A04966. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-27

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-27

Question

I see that the anti-TMEM107 antibody A04966 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-03-15

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-03-15

Question

Will anti-TMEM107 antibody A04966 work for WB with right uterine tube?

Verified Customer

Verified customer

Asked: 2019-02-21

Answer

According to the expression profile of right uterine tube, TMEM107 is highly expressed in right uterine tube. So, it is likely that anti-TMEM107 antibody A04966 will work for WB with right uterine tube.

Boster Scientific Support

Answered: 2019-02-21

Question

Would A04966 anti-TMEM107 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-12-24

Answer

It shows on the product datasheet, A04966 anti-TMEM107 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-12-24

Question

I have a question about product A04966, anti-TMEM107 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-11-14

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04966 anti-TMEM107 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-14

Question

Is a blocking peptide available for product anti-TMEM107 antibody (A04966)?

Verified Customer

Verified customer

Asked: 2018-08-23

Answer

We do provide the blocking peptide for product anti-TMEM107 antibody (A04966). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-08-23

Question

My question regards to test anti-TMEM107 antibody A04966 on human right uterine tube for research purposes, then I may be interested in using anti-TMEM107 antibody A04966 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

P. Krishna

Verified customer

Asked: 2018-07-12

Answer

The products we sell, including anti-TMEM107 antibody A04966, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-07-12

Question

Is there a BSA free version of anti-TMEM107 antibody A04966 available?

J. Taylor

Verified customer

Asked: 2018-07-12

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TMEM107 antibody A04966 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-07-12

Question

I was wanting to use your anti-TMEM107 antibody for WB for human right uterine tube on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human right uterine tube identification?

Verified Customer

Verified customer

Asked: 2017-09-19

Answer

It shows on the product datasheet, A04966 anti-TMEM107 antibody has been tested for Flow Cytometry, IHC-P, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human right uterine tube in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-19

Question

Will anti-TMEM107 antibody A04966 work on pig Flow Cytometry with right uterine tube?

N. Huang

Verified customer

Asked: 2016-11-30

Answer

Our lab technicians have not tested anti-TMEM107 antibody A04966 on pig. You can run a BLAST between pig and the immunogen sequence of anti-TMEM107 antibody A04966 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig right uterine tube in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-11-30

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for right uterine tube using anti-TMEM107 antibody A04966. Let me know if you need anything else.

K. Carter

Verified customer

Asked: 2014-07-25

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-07-25

Order DetailsPrice
A04966

100μg

$370
A04966-10ug

10μg sample (liquid)

$99
A04966-Biotin

100 μg Biotin conjugated

$570
A04966-Cy3

100 μg Cy3 conjugated

$570
A04966-Dylight488

100 μg Dylight488 conjugated

$570
A04966-Dylight550

100 μg Dylight550 conjugated

$570
A04966-Dylight594

100 μg Dylight594 conjugated

$570
A04966-FITC

100 μg FITC conjugated

$570
A04966-HRP

100 μg HRP conjugated

$570
A04966-APC

100 μg APC conjugated

$670
A04966-PE

100 μg PE conjugated

$670
A04966-iFluor647

100 μg iFluor647 conjugated

$670
A04966-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04966
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.