Click image to see more details
Product Info Summary
| SKU: | RP1092 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Thrombin Receptor/F2R Antibody Picoband®
View all PAR1/Thrombin Receptor Antibodies
SKU/Catalog Number
RP1092
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Thrombin Receptor/F2R Antibody catalog # RP1092. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Thrombin Receptor/F2R Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1092)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
RP1092 is reactive to F2R in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
47 kDa
Calculated molecular weight
47441 MW
Background of PAR1/Thrombin Receptor
Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
RP1092 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: MCF-7 Whole Cell, HELA Whole Cell, 22RV1 Whole Cell, SW620 Whole Cell
IHC: Human Placenta Tissue
Validation Images & Assay Conditions
Click image to see more details
Anti-Thrombin Receptor antibody, RP1092, IHC(P)
IHC(P): Human Placenta Tissue
Click image to see more details
Anti-Thrombin Receptor antibody, RP1092, Western blotting
All lanes: Anti Thrombin Receptor (RP1092) at 0.5ug/ml
Lane 1: MCF-7 Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: 22RV1 Whole Cell Lysate at 40ug
Lane 4: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
Protein Target Info & Infographic
Gene/Protein Information For F2R (Source: Uniprot.org, NCBI)
Gene Name
F2R
Full Name
Proteinase-activated receptor 1
Weight
47441 MW
Superfamily
G-protein coupled receptor 1 family
Alternative Names
Proteinase-activated receptor 1;PAR-1;Coagulation factor II receptor;Thrombin receptor;F2R;CF2R, PAR1, TR; F2R CF2R, HTR, PAR-1, PAR1, TR coagulation factor II thrombin receptor proteinase-activated receptor 1|protease-activated receptor 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on F2R, check out the F2R Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for F2R: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Thrombin Receptor/F2R Antibody Picoband® (RP1092)
Hello CJ!
No publications found for RP1092
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Thrombin Receptor/F2R Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Thrombin Receptor/F2R Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Thrombin Receptor/F2R Antibody Picoband®
Question
Has RP1092 been tested for other samples?
Verified customer
Asked: 2020-10-29
Answer
The Anti-Thrombin Receptor/F2R Antibody (RP1092) is only suitable for human samples.
Boster Scientific Support
Answered: 2020-10-30
Question
Does RP1092 anti-Thrombin Receptor/F2R antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-04-30
Answer
It shows on the product datasheet, RP1092 anti-Thrombin Receptor/F2R antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-30
Question
Would anti-Thrombin Receptor/F2R antibody RP1092 work on feline IHC with decidua?
Verified Customer
Verified customer
Asked: 2020-02-18
Answer
Our lab technicians have not validated anti-Thrombin Receptor/F2R antibody RP1092 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Thrombin Receptor/F2R antibody RP1092 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline decidua in IHC, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-18
Question
I was wanting to use your anti-Thrombin Receptor/F2R antibody for IHC for human decidua on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human decidua identification?
Verified Customer
Verified customer
Asked: 2020-01-09
Answer
As indicated on the product datasheet, RP1092 anti-Thrombin Receptor/F2R antibody has been tested for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human decidua in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-01-09
Question
We are currently using anti-Thrombin Receptor/F2R antibody RP1092 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2019-07-22
Answer
The anti-Thrombin Receptor/F2R antibody (RP1092) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-07-22
Question
I was wanting to use to test anti-Thrombin Receptor/F2R antibody RP1092 on human decidua for research purposes, then I may be interested in using anti-Thrombin Receptor/F2R antibody RP1092 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
N. Dhar
Verified customer
Asked: 2016-06-27
Answer
The products we sell, including anti-Thrombin Receptor/F2R antibody RP1092, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2016-06-27
Question
Is this RP1092 anti-Thrombin Receptor/F2R antibody reactive to the isotypes of F2R?
N. Johnson
Verified customer
Asked: 2014-04-10
Answer
The immunogen of RP1092 anti-Thrombin Receptor/F2R antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-04-10
